Ir directamente a la información del producto
1 de 1

Thymosin Beta 4 5mg TB500

Thymosin Beta 4 5mg TB500

Pharma-grade testosterone for optimized hormone levels, muscle mass retention, and peak vitality — 300mg/mL.

Precio habitual $85.00 USD
Precio habitual Precio de oferta $85.00 USD
Oferta Agotado
Impuestos incluidos. Los gastos de envío se calculan en la pantalla de pago.

Ships in 24 Hours — Discreet. Secure. Trackable.

Tags: #Immortal Medicals

SKU: SKU:

  • Express delivery available
  • Free Reship Guaranteed
Ver todos los detalles
  • Product Overview
  • Shipping Information
  • How to pay
  • Purity
  • Third-Party Tested
  • Science-Backed

TB-500 5mg - High-Quality Research Peptide

TB-500, offered at 5mg, is a high-quality, specialised research peptide developed for advanced scientific exploration in cellular biology and actin-related signalling pathways. This product is ideal for laboratory settings where precision and reliability are paramount.

  • Product Name: TB-500 5mg
  • Catalogue Number: TB500-5mg
  • Molecular Formula: C212H350N56O78S
  • Molecular Weight: 4963.4 g/mol
  • Purity: ≥98%
  • Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Form: Lyophilised Solid

Storage and Handling:

TB-500 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. Store the sealed vial at -20°C, protected from light and moisture. All handling and laboratory procedures are determined by the receiving laboratory under its own protocols.

Synthesis and Quality Assurance:

TB-500 is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

 

Testosterone Enanthate (300mg/mL) is a powerful injectable compound designed for optimal hormone replacement therapy and performance enhancement. Known for its long ester and consistent absorption rate, it’s ideal for both first-time users and experienced protocols alike.

Testosterone Enanthate (300mg/mL) is a powerful injectable compound designed for optimal hormone replacement therapy and performance enhancement. Known for its long ester and consistent absorption rate, it’s ideal for both first-time users and experienced protocols alike.

Testosterone Enanthate (300mg/mL) is a powerful injectable compound designed for optimal hormone replacement therapy and performance enhancement. Known for its long ester and consistent absorption rate, it’s ideal for both first-time users and experienced protocols alike.

Testosterone Enanthate (300mg/mL) is a powerful injectable compound designed for optimal hormone replacement therapy and performance enhancement. Known for its long ester and consistent absorption rate, it’s ideal for both first-time users and experienced protocols alike.

Testosterone Enanthate (300mg/mL) is a powerful injectable compound designed for optimal hormone replacement therapy and performance enhancement. Known for its long ester and consistent absorption rate, it’s ideal for both first-time users and experienced protocols alike.

  • Choose Your Compounds

    Browse from high-potency injectables, capsules, and research-backed stacks designed for peak output.

  • Secure, Discreet Shipping

    Every order ships fast in tamper-proof packaging with full tracking no guesswork, no labels that raise questions.

  • Auto Refill Available

    Never miss a dose. Maintain optimal blood levels with optional refill scheduling and reorder alerts.

  • GMP Certified

    Our supplements are manufactured in facilities that follow Good Manufacturing Practices, ensuring purity, consistency, and excellence

  • Pharmacy-Grade Formulation

    Every order ships fast in tamper-proof packaging with full tracking — no guesswork, no labels that raise questions.

  • ISO Certified

    Each ingredient is selected with care and precision, meeting professional standards trusted by healthcare providers.

  • Lab-Tested

    Scientifically formulated and rigorously tested for efficacy and safety, so you can feel confident in every dose.

  • David M, Los Angeles, CA

  • Ana K, Austin, TX

  • Jon R, Brooklyn, NY

  • Marcos T, Miami, FL

  • Emily C, San Diego, CA

  • Zane P, London, UK

How it works

Start your search here:

1. Find and order your medications

Browse our medical-grade products. Backed by science. Delivered to your door in 24 hours.

2. Receive your meds in the mail

Every order ships in discreet packaging with tracked delivery and medical-grade storage.

3. Need a refill?

Easily manage your prescriptions from your dashboard—no doctor visit required.

Worldwide Discreet Shipping

We serve customers in over 37 countries

We have put together some commonly asked questions

Everything You Need to Know Before You Start

How does Immortal’s protocol system actually work?

Our protocol is precision engineered to restore optimal hormone balance. After your online assessment, our licensed physicians review your health profile and prescribe a tailored treatment. Your personalized meds are discreetly delivered, with ongoing support and adjustments based on your progress.

What’s included in the pricing — and what am I really paying for?

You’re paying for a complete medical-grade system: no doctor prescription needed, premium pharmaceutical compounds, lab-tested formulation, discreet delivery, and 24/7 patient support. No hidden fees — just results-driven wellness in every dose.

What’s the best way to set fitness or hormone goals before starting?

Start by identifying what you want to change energy, muscle mass, fat loss, focus, libido. Our onboarding flow guides you through a detailed goal setting process, and your assigned physician tailors treatment to get you there faster, safer, and smarter.

Is shipping discreet? Will anyone know what’s in the box?

Yes. Every package is shipped in discreet, unmarked boxes with no mention of what’s inside. Your treatment and privacy are our priority always protected, always confidential.

How fast can I expect results from testosterone therapy?

Most users report noticeable results within 2–4 weeks including sharper focus, improved drive, leaner muscle tone, and better recovery. Full benefits compound over 8–12 weeks with consistency.

What if I miss a dose, will it affect my cycle?

Missing one dose won’t drastically affect your progress. Just resume your regular schedule but consistency is key for optimal hormone balance. If you miss multiple doses, reach out to your care team and they’ll guide your next steps.