Thymosin Beta 4 5mg TB500

Pharma-grade compound. Independently HPLC-tested every batch. Certificate of Analysis available on request. Shipped worldwide in plain, tracked packaging.

21 total reviews

Regular price $85.00
Taxes included. Shipping calculated at checkout.

Dispatched in 48 hours. Stealth. Tracked. Reship guaranteed.

Tags: #Immortal Medicals

  • Dispatched in 48 hours
  • Seized or lost? Free reship — no questions.
View full details
  • Product Overview
  • Shipping & delivery
  • How to pay
  • Purity & dosage
  • Third-party tested + customer bloodwork-verified
  • Storage, dosing, cycle support

TB-500 5mg – High-Quality Research Peptide

TB-500, offered at 5mg, is a high-quality, specialised research peptide developed for advanced scientific exploration in cellular biology and actin-related signalling pathways. This product is ideal for laboratory settings where precision and reliability are paramount.

  • Product Name: TB-500 5mg
  • Catalogue Number: TB500-5mg
  • Molecular Formula: C212H350N56O78S
  • Molecular Weight: 4963.4 g/mol
  • Purity: ≥98%
  • Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Form: Lyophilised Solid

Storage and Handling:

TB-500 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. Store the sealed vial at -20°C, protected from light and moisture. All handling and laboratory procedures are determined by the receiving laboratory under its own protocols.

Synthesis and Quality Assurance:

TB-500 is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

 

Dispatched within 48 hours of payment confirmation. Plain, unmarked, tamper-evident box. Generic shipping label from a neutral logistics name — nothing on the outside identifies the contents or Immortal Medicals. Full tracking. Signature optional. Worldwide. Pack seized or lost? Free reship, no questions.

Card (Visa, MC, Amex), crypto (BTC, ETH, USDT — 5% off your order), or bank transfer for larger orders. Discreet billing descriptor on every method. Crypto clears in minutes, no chargebacks, no bank-side flag — it's the fastest and most private. Returning customers get loyalty pricing and priority dispatch.

≥99% purity verified by independent HPLC analysis. Dosage tested batch-by-batch — what you see on the label is what's in the vial. Certificate of Analysis available on request, including full chromatogram, batch number, and manufacture date. The CoAs are real chromatograms, not the one-page fake Word docs other sources send.

HPLC tested by an independent third-party lab on every batch. On top of that, hundreds of customers run their own pre- and post-cycle bloodwork on our compounds and post results publicly. The receipts are everywhere — go look before you buy.

Every compound ships with storage instructions, half-life data, and a recommended dosing range for the goal. Need cycle guidance, PCT planning, or help with ancillaries? Message the team — we've been at this long enough to give you real answers, not sales scripts.

  • 1. Pick your compounds

    Browse by goal — mass, cut, recomp, recovery, PCT. Need help picking a stack? Use the free goal-finder or DM the team — we'll send back a tailored recommendation in 24 hours.

  • 2. Stealth at the door

    Plain, unmarked box. Tamper-evident, fully tracked. Neutral shipper name on the label. Mail carrier won't know. Neighbor won't know. Only you know.

  • 3. Re-order with loyalty pricing

    Returning customers get loyalty pricing, early access to new compounds, and priority dispatch. Re-order from your account in two clicks.

  • GMP-Certified Labs

    Sourced exclusively from GMP-licensed laboratories on real pharma raws. No UGL, no kitchen brews, no compromise on raws quality.

  • Pharma-grade raws

    Same active ingredients used in pharmacy-grade product. Tested for identity and concentration before they ever leave the lab.

  • HPLC-tested every batch

    Independent third-party HPLC analysis on every batch — purity, dosage, identity verified. CoA on request, real chromatogram included.

  • Bloodwork-verified

    The real proof. Hundreds of customers run pre/post-cycle bloods on our gear and post the results publicly. The receipts are out there — check before you buy.

  • M. Reyes · Test E 500/wk + Anavar 50/d · 8 weeks

  • J. Carter · Test C + EQ + Anadrol kickstart · 16 weeks

  • D. Kim · Cutting prep: Test P + Mast P + Winny · 10 wks

  • A. Powell · 14 cycles deep · Runs his own HPLC

  • B. Singh · Test E 600 + Deca 400 + Dbol · 14 weeks

  • T. O'Brien · Cruise dose only · 200mg/wk · Re-ordered 3x

How it works

Start here:

1. Pick your compounds. Add to cart.

Browse by goal — mass, cut, recomp, recovery, PCT. Need help? Use the free goal-finder for a tailored stack recommendation in 24 hours.

2. Pay discreetly, dispatched in 48hr

Card, crypto (5% off), or bank transfer. Discreet billing descriptor. Order dispatched within 48 hours in plain, unmarked, tracked packaging.

3. Re-order with loyalty pricing

Returning customers get loyalty pricing, priority dispatch, and early access to new compounds. Re-order from your account in two clicks.

Stealth shipping worldwide

Stealth shipping. Free reship if stopped. 37+ countries.

Real answers, no marketing fluff

Before you order — the real questions

Add to cart. Check out (card / crypto / bank). Dispatched within 48 hours in plain, unmarked, tracked packaging. Worldwide. If anything goes wrong in transit — seized, lost, damaged — we reship free. That simple.

The compound itself, stealth packaging, full tracked shipping, and the reship guarantee if your pack gets stopped. No surprise fees, no upcharge at checkout. Crypto pays 5% off the order total. Bundle multiple compounds for cycle-length pricing.

Use the free stack consultation. Tell us your goal, training experience, cycle history, and we'll send back a tailored recommendation — compounds, doses, length, ancillaries, PCT — in 24 hours. No pressure to order. Most guys ask, refine, then check out the same week.

Plain, unmarked, tamper-evident box. Generic shipping label from a neutral logistics name. Nothing on the outside references the contents or Immortal Medicals. Card statement shows a discreet, unrelated billing descriptor. Signature optional. Your mail carrier won't know. Your roommate won't know. Only you know.

Depends on the compound. Fast-acting orals (Dbol, Anadrol, Anavar) — strength up in week 1, scale moving by week 2. Injectable bases (Test E, C, Sustanon, Deca, EQ) — kick in by weeks 3–4, peak 6–8. Tren, Mast, Winny — visible in the mirror within 2–3 weeks. Run a mid-cycle blood to confirm levels are where they should be.

Free reship. Pack seized, lost, or delayed past 30 business days? Message us with the tracking and we ship a replacement at our cost. No "send a police report" hoops, no prorated nonsense. That guarantee is the reason new customers risk the first order — and the reason long-time customers stop testing other sources.