Thymosin Beta 4 5mg TB500
Pharma-grade compound. Independently HPLC-tested every batch. Certificate of Analysis available on request. Shipped worldwide in plain, tracked packaging.
4.43 / 5.0
(21) 21 total reviews
Dispatched in 48 hours. Stealth. Tracked. Reship guaranteed.
Tags: #Immortal Medicals
Dispatched in 48 hours
Seized or lost? Free reship — no questions.
- Product Overview
- Shipping & delivery
- How to pay
- Purity & dosage
- Third-party tested + customer bloodwork-verified
- Storage, dosing, cycle support
TB-500 5mg – High-Quality Research Peptide
TB-500, offered at 5mg, is a high-quality, specialised research peptide developed for advanced scientific exploration in cellular biology and actin-related signalling pathways. This product is ideal for laboratory settings where precision and reliability are paramount.
- Product Name: TB-500 5mg
- Catalogue Number: TB500-5mg
- Molecular Formula: C212H350N56O78S
- Molecular Weight: 4963.4 g/mol
- Purity: ≥98%
- Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Form: Lyophilised Solid
Storage and Handling:
TB-500 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. Store the sealed vial at -20°C, protected from light and moisture. All handling and laboratory procedures are determined by the receiving laboratory under its own protocols.
Synthesis and Quality Assurance:
TB-500 is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.
Dispatched within 48 hours of payment confirmation. Plain, unmarked, tamper-evident box. Generic shipping label from a neutral logistics name — nothing on the outside identifies the contents or Immortal Medicals. Full tracking. Signature optional. Worldwide. Pack seized or lost? Free reship, no questions.
Card (Visa, MC, Amex), crypto (BTC, ETH, USDT — 5% off your order), or bank transfer for larger orders. Discreet billing descriptor on every method. Crypto clears in minutes, no chargebacks, no bank-side flag — it's the fastest and most private. Returning customers get loyalty pricing and priority dispatch.
≥99% purity verified by independent HPLC analysis. Dosage tested batch-by-batch — what you see on the label is what's in the vial. Certificate of Analysis available on request, including full chromatogram, batch number, and manufacture date. The CoAs are real chromatograms, not the one-page fake Word docs other sources send.
HPLC tested by an independent third-party lab on every batch. On top of that, hundreds of customers run their own pre- and post-cycle bloodwork on our compounds and post results publicly. The receipts are everywhere — go look before you buy.
Every compound ships with storage instructions, half-life data, and a recommended dosing range for the goal. Need cycle guidance, PCT planning, or help with ancillaries? Message the team — we've been at this long enough to give you real answers, not sales scripts.
Lifters running this also ordered…
-
BPC-157 5mg
4.80 / 5.0
(12) 12 total reviews
Regular price$115.00 -
GHRP-6 5mg
4.80 / 5.0
(12) 12 total reviews
Regular price$115.00 -
TB500 (#58)
4.80 / 5.0
(12) 12 total reviews
Regular price$115.00 -
CJC-1295 2mg (with DAC)
4.80 / 5.0
(12) 12 total reviews
Regular price$115.00
How ordering works
-
1. Pick your compounds
Browse by goal — mass, cut, recomp, recovery, PCT. Need help picking a stack? Use the free goal-finder or DM the team — we'll send back a tailored recommendation in 24 hours.
-
2. Stealth at the door
Plain, unmarked box. Tamper-evident, fully tracked. Neutral shipper name on the label. Mail carrier won't know. Neighbor won't know. Only you know.
-
3. Re-order with loyalty pricing
Returning customers get loyalty pricing, early access to new compounds, and priority dispatch. Re-order from your account in two clicks.
-
GMP-Certified Labs
Sourced exclusively from GMP-licensed laboratories on real pharma raws. No UGL, no kitchen brews, no compromise on raws quality.
-
Pharma-grade raws
Same active ingredients used in pharmacy-grade product. Tested for identity and concentration before they ever leave the lab.
-
HPLC-tested every batch
Independent third-party HPLC analysis on every batch — purity, dosage, identity verified. CoA on request, real chromatogram included.
-
Bloodwork-verified
The real proof. Hundreds of customers run pre/post-cycle bloods on our gear and post the results publicly. The receipts are out there — check before you buy.
What lifters running this compound actually say
-
M. Reyes · Test E 500/wk + Anavar 50/d · 8 weeks
-
J. Carter · Test C + EQ + Anadrol kickstart · 16 weeks
-
D. Kim · Cutting prep: Test P + Mast P + Winny · 10 wks
-
A. Powell · 14 cycles deep · Runs his own HPLC
-
B. Singh · Test E 600 + Deca 400 + Dbol · 14 weeks
-
T. O'Brien · Cruise dose only · 200mg/wk · Re-ordered 3x
cycle reports
What lifters say
"I source-tested Immortal against three others. They were the only ones that matched their own CoA."
I sent samples from four suppliers to a private lab. Three came back underdosed by 15-30%. Immortal came back within 2% of label. That's not luck. That's QC. That's why they have my recurring order.
L. Richi
Independently HPLC-verified
cycle reports
Real gear. Real bloods. See why lifters stay on Immortal.
"Three sources, three years, three different ways to get burned. First Immortal cycle ran textbook — trough T proportional to dose, no PIP, dry strength up every session. The CoA matched my own HPLC. Done shopping."
L. Richi
Test E + Anavar finisher
cycle reports
What lifters say
"DM'd the team for dosing advice. Got an actual answer — not a sales script."
I was deciding between two cycle structures. Asked the team. They came back with the case for both, told me which was better for my goal and why, and didn't try to upsell me a single ml. That's how you earn the second order.
L. Richi
Long-term customer
cycle reports
What lifters say
"I source-tested Immortal against three others. They were the only ones that matched their own CoA."
I sent samples from four suppliers to a private lab. Three came back underdosed by 15-30%. Immortal came back within 2% of label. That's not luck. That's QC. That's why they have my recurring order.
L. Richi
Independently HPLC-verified
cycle reports
Real gear. Real bloods. See why lifters stay on Immortal.
"Three sources, three years, three different ways to get burned. First Immortal cycle ran textbook — trough T proportional to dose, no PIP, dry strength up every session. The CoA matched my own HPLC. Done shopping."
L. Richi
Test E + Anavar finisher
How it works
Start here:
1. Pick your compounds. Add to cart.
Browse by goal — mass, cut, recomp, recovery, PCT. Need help? Use the free goal-finder for a tailored stack recommendation in 24 hours.
2. Pay discreetly, dispatched in 48hr
Card, crypto (5% off), or bank transfer. Discreet billing descriptor. Order dispatched within 48 hours in plain, unmarked, tracked packaging.
3. Re-order with loyalty pricing
Returning customers get loyalty pricing, priority dispatch, and early access to new compounds. Re-order from your account in two clicks.
Stealth shipping worldwide
Stealth shipping. Free reship if stopped. 37+ countries.
Goes well in the cycle
-
Save: $4.00Testosterone Enanthate (#2)
3.65 / 5.0
(17) 17 total reviews
Regular price $86.00Regular priceUnit price / per$90.00Sale price $86.00Save: $4.00 -
Testosterone Cypionate (#3)
4.44 / 5.0
(9) 9 total reviews
Regular price $107.00Regular priceUnit price / per$107.00Sale price $0.00 -
Save: $12.00Trenbolone Acetate (#19)
5.0 / 5.0
(7) 7 total reviews
Regular price $97.00Regular priceUnit price / per$109.00Sale price $97.00Save: $12.00
Real answers, no marketing fluff
Before you order — the real questions
How does ordering work?
Add to cart. Check out (card / crypto / bank). Dispatched within 48 hours in plain, unmarked, tracked packaging. Worldwide. If anything goes wrong in transit — seized, lost, damaged — we reship free. That simple.
What's included in the price?
The compound itself, stealth packaging, full tracked shipping, and the reship guarantee if your pack gets stopped. No surprise fees, no upcharge at checkout. Crypto pays 5% off the order total. Bundle multiple compounds for cycle-length pricing.
How do I know which stack is right for me?
Use the free stack consultation. Tell us your goal, training experience, cycle history, and we'll send back a tailored recommendation — compounds, doses, length, ancillaries, PCT — in 24 hours. No pressure to order. Most guys ask, refine, then check out the same week.
Is shipping really stealth?
Plain, unmarked, tamper-evident box. Generic shipping label from a neutral logistics name. Nothing on the outside references the contents or Immortal Medicals. Card statement shows a discreet, unrelated billing descriptor. Signature optional. Your mail carrier won't know. Your roommate won't know. Only you know.
How fast do I see results?
Depends on the compound. Fast-acting orals (Dbol, Anadrol, Anavar) — strength up in week 1, scale moving by week 2. Injectable bases (Test E, C, Sustanon, Deca, EQ) — kick in by weeks 3–4, peak 6–8. Tren, Mast, Winny — visible in the mirror within 2–3 weeks. Run a mid-cycle blood to confirm levels are where they should be.
What if my pack gets stopped?
Free reship. Pack seized, lost, or delayed past 30 business days? Message us with the tracking and we ship a replacement at our cost. No "send a police report" hoops, no prorated nonsense. That guarantee is the reason new customers risk the first order — and the reason long-time customers stop testing other sources.