Thymosin Beta 4 5mg TB500
Thymosin Beta 4 5mg TB500
Pharma-grade testosterone for optimized hormone levels, muscle mass retention, and peak vitality — 300mg/mL.
Impossible de charger la disponibilité du service de retrait
Ships in 24 Hours — Discreet. Secure. Trackable.
Share
Tags: #Immortal Medicals
SKU: SKU:
Express delivery available
Free Reship Guaranteed
- Product Overview
- Shipping Information
- How to pay
- Purity
- Third-Party Tested
- Science-Backed
TB-500 5mg - High-Quality Research Peptide
TB-500, offered at 5mg, is a high-quality, specialised research peptide developed for advanced scientific exploration in cellular biology and actin-related signalling pathways. This product is ideal for laboratory settings where precision and reliability are paramount.
- Product Name: TB-500 5mg
- Catalogue Number: TB500-5mg
- Molecular Formula: C212H350N56O78S
- Molecular Weight: 4963.4 g/mol
- Purity: ≥98%
- Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Form: Lyophilised Solid
Storage and Handling:
TB-500 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. Store the sealed vial at -20°C, protected from light and moisture. All handling and laboratory procedures are determined by the receiving laboratory under its own protocols.
Synthesis and Quality Assurance:
TB-500 is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.
Testosterone Enanthate (300mg/mL) is a powerful injectable compound designed for optimal hormone replacement therapy and performance enhancement. Known for its long ester and consistent absorption rate, it’s ideal for both first-time users and experienced protocols alike.
Testosterone Enanthate (300mg/mL) is a powerful injectable compound designed for optimal hormone replacement therapy and performance enhancement. Known for its long ester and consistent absorption rate, it’s ideal for both first-time users and experienced protocols alike.
Testosterone Enanthate (300mg/mL) is a powerful injectable compound designed for optimal hormone replacement therapy and performance enhancement. Known for its long ester and consistent absorption rate, it’s ideal for both first-time users and experienced protocols alike.
Testosterone Enanthate (300mg/mL) is a powerful injectable compound designed for optimal hormone replacement therapy and performance enhancement. Known for its long ester and consistent absorption rate, it’s ideal for both first-time users and experienced protocols alike.
Testosterone Enanthate (300mg/mL) is a powerful injectable compound designed for optimal hormone replacement therapy and performance enhancement. Known for its long ester and consistent absorption rate, it’s ideal for both first-time users and experienced protocols alike.

How to Start Your Immortal Protocol
-
Choose Your Compounds
Browse from high-potency injectables, capsules, and research-backed stacks designed for peak output.
-
Secure, Discreet Shipping
Every order ships fast in tamper-proof packaging with full tracking no guesswork, no labels that raise questions.
-
Auto Refill Available
Never miss a dose. Maintain optimal blood levels with optional refill scheduling and reorder alerts.
-
GMP Certified
Our supplements are manufactured in facilities that follow Good Manufacturing Practices, ensuring purity, consistency, and excellence
-
Pharmacy-Grade Formulation
Every order ships fast in tamper-proof packaging with full tracking — no guesswork, no labels that raise questions.
-
ISO Certified
Each ingredient is selected with care and precision, meeting professional standards trusted by healthcare providers.
-
Lab-Tested
Scientifically formulated and rigorously tested for efficacy and safety, so you can feel confident in every dose.
OUR HAPPY CUSTOMERS
-
David M, Los Angeles, CA
-
Ana K, Austin, TX
-
Jon R, Brooklyn, NY
-
Marcos T, Miami, FL
-
Emily C, San Diego, CA
-
Zane P, London, UK
testimonials
Real Results. Real People. See Why Millions Trust Immortal.
“Since starting Immortal, I’ve seen real gains in strength and confidence. The results speak for themselves.”
Laura Richi
New York
testimonials Row
What our clients say
Consectetur adipiscing elit, sed do eiusm onsectetur adipiscing elit,
Consectetur adipiscing elit, sed do eiusm onsectetur adipiscing elit, sed do eiusm odtempor incididunt ut labore
Laura Richi
New York
testimonials Row
What our clients say
Consectetur adipiscing elit, sed do eiusm onsectetur adipiscing elit,
Consectetur adipiscing elit, sed do eiusm onsectetur adipiscing elit, sed do eiusm odtempor incididunt ut labore
Laura Richi
New York
How it works
Start your search here:
1. Find and order your medications
Browse our medical-grade products. Backed by science. Delivered to your door in 24 hours.
2. Receive your meds in the mail
Every order ships in discreet packaging with tracked delivery and medical-grade storage.
3. Need a refill?
Easily manage your prescriptions from your dashboard—no doctor visit required.
Worldwide Discreet Shipping
We serve customers in over 37 countries
Frequently Bought Together
-
Save: $4.00Testosterone Enanthate (#2)
3.65 / 5.0
(17) 17 total des critiques
Prix habituel $86.00 USDPrix habituelPrix unitaire / par$90.00 USDPrix promotionnel $86.00 USDSave: $4.00 -
Testosterone Cypionate (#3)
4.5 / 5.0
(10) 10 total des critiques
Prix habituel $107.00 USDPrix habituelPrix unitaire / parPrix promotionnel $107.00 USD -
Save: $12.00Trenbolone Acetate (#19)
5.0 / 5.0
(7) 7 total des critiques
Prix habituel $97.00 USDPrix habituelPrix unitaire / par$109.00 USDPrix promotionnel $97.00 USDSave: $12.00
We have put together some commonly asked questions
Everything You Need to Know Before You Start
How does Immortal’s protocol system actually work?
Our protocol is precision engineered to restore optimal hormone balance. After your online assessment, our licensed physicians review your health profile and prescribe a tailored treatment. Your personalized meds are discreetly delivered, with ongoing support and adjustments based on your progress.
What’s included in the pricing — and what am I really paying for?
You’re paying for a complete medical-grade system: no doctor prescription needed, premium pharmaceutical compounds, lab-tested formulation, discreet delivery, and 24/7 patient support. No hidden fees — just results-driven wellness in every dose.
What’s the best way to set fitness or hormone goals before starting?
Start by identifying what you want to change energy, muscle mass, fat loss, focus, libido. Our onboarding flow guides you through a detailed goal setting process, and your assigned physician tailors treatment to get you there faster, safer, and smarter.
Is shipping discreet? Will anyone know what’s in the box?
Yes. Every package is shipped in discreet, unmarked boxes with no mention of what’s inside. Your treatment and privacy are our priority always protected, always confidential.
How fast can I expect results from testosterone therapy?
Most users report noticeable results within 2–4 weeks including sharper focus, improved drive, leaner muscle tone, and better recovery. Full benefits compound over 8–12 weeks with consistency.
What if I miss a dose, will it affect my cycle?
Missing one dose won’t drastically affect your progress. Just resume your regular schedule but consistency is key for optimal hormone balance. If you miss multiple doses, reach out to your care team and they’ll guide your next steps.
- Le choix d'une sélection entraîne l'actualisation de la page entière.
- S'ouvre dans une nouvelle fenêtre.